DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18659 and AT5G35560

DIOPT Version :9

Sequence 1:NP_665880.2 Gene:CG18659 / 35929 FlyBaseID:FBgn0027561 Length:908 Species:Drosophila melanogaster
Sequence 2:NP_568527.2 Gene:AT5G35560 / 833521 AraportID:AT5G35560 Length:765 Species:Arabidopsis thaliana


Alignment Length:392 Identity:78/392 - (19%)
Similarity:142/392 - (36%) Gaps:110/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EVLTGIPSF-AFPC---------DTTSTSVQTYSFVHTTGDSKWRFGFCRQDPRTNTAMVLITYL 109
            |:.....|| |.||         |.|.|...::|               .||..::...:|    
plant   406 EISDSSTSFQAAPCERRHSRTSADDTETDEASFS---------------GQDDTSSNFDIL---- 451

  Fly   110 PWHDTFLKLLPVLAELRRTDPNGFRTFLSEAYNQGIPDCGGSLKVYYSAGQSHFTFERPLQFQLP 174
                          |..::..||....|.|.|....| ..||...::.....|     |:::..|
plant   452 --------------EWAKSKKNGSLQILCEYYQLKCP-ARGSTITFHPLEHLH-----PVEYHRP 496

  Fly   175 SMPENH-------------NLNL---YYNFVEPKE--------------------MIAVFAAMLA 203
            :....|             :|.|   :...:..:|                    ::.:.|..|.
plant   497 NEVALHTPGSAIDLRSCSTSLELAEAHTTLMAEEEAAALSTWAVASLCGSLRLDNVLMILAGALL 561

  Fly   204 ERRIIFTSRHLDRLSSCIQAANAFLYPMVWQHIFIPVLPWEFKDYLGAPMPYLIGVPEPVLETVT 268
            |::|:|...:|..|::.:.:....:.|..||.:.:||||.:..::|.||:||::||.....|  .
plant   562 EKQIVFVCSNLGILAASVLSIIPVIRPFRWQSLLMPVLPDDMLEFLDAPVPYIVGVKNKTSE--V 624

  Fly   269 SDELGEVVILNCDTKIFESP-------FDDVHNLPTEIVSQL-------KKHLNHTHDHIGDRIS 319
            ..:|..|::::......:||       :.|::|..:...|:|       ||...:....:....:
plant   625 QSKLTNVIVVDILKNQVKSPSMPQLPQYRDLYNALSPYHSKLVGESYLAKKRPVYECTDVQVDAA 689

  Fly   320 KIFLNALVQLIGGYRDAVEYH-------ENSKT--FNSQKFIESRPAHLRPFLAKMMDLQIFAQF 375
            |.|::.|...:......::.|       .|.|.  ...:.||:|.|:..|||:...:|.|:|:..
plant   690 KGFMDVLRSYLDSLCSNLQSHTITNVQSNNDKVSLLLKESFIDSFPSRQRPFMKLFVDTQLFSVH 754

  Fly   376 ID 377
            .|
plant   755 TD 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18659NP_665880.2 uDENN 10..95 CDD:214824 10/49 (20%)
DENN 98..282 CDD:280329 41/219 (19%)
dDENN 315..379 CDD:129037 17/72 (24%)
AT5G35560NP_568527.2 uDENN 160..236 CDD:281455
DENN 455..639 CDD:214823 39/191 (20%)
dDENN 727..>763 CDD:281454 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3203
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.