DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18659 and DENND2D

DIOPT Version :9

Sequence 1:NP_665880.2 Gene:CG18659 / 35929 FlyBaseID:FBgn0027561 Length:908 Species:Drosophila melanogaster
Sequence 2:XP_006710984.2 Gene:DENND2D / 79961 HGNCID:26192 Length:485 Species:Homo sapiens


Alignment Length:423 Identity:108/423 - (25%)
Similarity:188/423 - (44%) Gaps:71/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VIVESFPE------GFRDQE--VLTGIPSFAFP-----CDTTSTSVQTYSFVHTTGDSKWRFGFC 93
            :|...||:      |.:::|  :|..||.|.||     ...|....:|:|||.|..|...:.|:|
Human    88 IITYQFPKRENLLRGQQEEEERLLKAIPLFCFPDGNEWASLTEYPRETFSFVLTNVDGSRKIGYC 152

  Fly    94 RQ------DPRTNTAMVLITYLPWHDTFLKLL---------------PVLAELRRTD-PNGFRTF 136
            |:      .||......:|:.:.....|.|:|               |.:..||... |...:|.
Human   153 RRLL
PAGPGPRLPKVYCIISCIGCFGLFSKILDEVEKRHQISMAVIYPFMQGLREAAFPAPGKTV 217

  Fly   137 LSEAYNQGIPDCGGSLKVYYSAGQSHFTFERPLQFQLPSMPENHNLNLYYNFVEPKEMIAVFAAM 201
            ..:::   |||          :|....:..|||...|    |:.:.:...:.:..::::.:||:.
Human   218 TLKSF---IPD----------SGTEFISLTRPLDSHL----EHVDFSSLLHCLSFEQILQIFASA 265

  Fly   202 LAERRIIFTSRHLDRLSSCIQAANAFLYPMVWQHIFIPVLPWEFKDYLGAPMPYLIGVPEPVLET 266
            :.||:|||.:..|..||.||.||.|.|||..|.|.:|||:|......:..|.|:::||.....:.
Human   266 VLERKIIFLAEGLSTLSQCIHAAAALLYPFSWAHTYIPVVPESLLATVCCPTPFMVGVQMRFQQE 330

  Fly   267 VTSDELGEVVILN-CDTKIFESPFDDVHNLP----TEIVSQLKKHLNH--THDHIGDRISKIFLN 324
            |....:.||:::| |:.....|..|:...||    .:|:..|.:.:|.  |.:.|.:.:|..|:.
Human   331 VMDSPMEEVLLVNLCEG
TFLMSVGDEKDILPPKLQDDILDSLGQGINELKTAEQINEHVSGPFVQ 395

  Fly   325 ALVQLIGGYRDAVEYHENSK-TFNSQKFIESRPAHL-RPFLAKMMDLQIFAQFIDDRLTMLNSGL 387
            ..|:::|.|...::...|.: .|..:.|.::..:.. |.|:.|.:..|:|:.||.:.....|...
Human   396 FFVKIVGHYASYIKREANGQGHFQERSFCKALTSKTNRRFVKKFVKTQLFSLFIQEAEKSKNPPA 460

  Fly   388 GFSDEFELETVRYAEKKKRGRNYAIMKNLKDKT 420
            |:   |:.:.:.|.|:||:       |..::||
Human   461 GY---FQQKILEYEEQKKQ-------KKPREKT 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18659NP_665880.2 uDENN 10..95 CDD:214824 20/65 (31%)
DENN 98..282 CDD:280329 52/200 (26%)
dDENN 315..379 CDD:129037 15/65 (23%)
DENND2DXP_006710984.2 uDENN 64..156 CDD:214824 21/67 (31%)
DENN 163..347 CDD:280329 52/200 (26%)
dDENN 386..451 CDD:129037 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3569
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.