DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18659 and DENND2B

DIOPT Version :9

Sequence 1:NP_665880.2 Gene:CG18659 / 35929 FlyBaseID:FBgn0027561 Length:908 Species:Drosophila melanogaster
Sequence 2:XP_011518611.1 Gene:DENND2B / 6764 HGNCID:11350 Length:1187 Species:Homo sapiens


Alignment Length:473 Identity:120/473 - (25%)
Similarity:195/473 - (41%) Gaps:80/473 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKLFEFWCEVTPTPGLERGTSSRSGGPAVPAGVIVESFPEGFRD-------QEVLTGIPSFAFP- 66
            ::|||::..|:    |::..|..:..|.|.     ..||:..|.       :|.|..||.|.|| 
Human   724 RELFEYFVVVS----LKKKPSRNTYLPEVS-----YQFPKLDRPTKQMREAEERLKAIPQFCFPD 779

  Fly    67 ----CDTTSTSVQTYSFVHTTGDSKWRFGFCR--------------------------QDPRTNT 101
                ...:..|.:|:||:.|..|...|||:||                          :.||...
Human   780 AKDWLPVSEYSSETFSFMLTGEDGSRRFGYCRRLLFALLEWRWIKKGRKEAKKGMPSGKGPRLPE 844

  Fly   102 AMVLITYLPWHDTFLKLLPVLAELRRTDPNGFRTFLSEAYNQGIPDCGGSLKV---YYSAGQSHF 163
            ...:|:.|.....|.|:|..:...|.........|:........|..|.::||   ...||....
Human   845 VYCVISRLGCFGLFSKVLDEVERRRGISAALVYPFMRSLMESPFPAPGKTIKVKTFLPGAGNEVL 909

  Fly   164 TFERPLQFQLPSMPENHNLNLYYNFVEPKEMIAVFAAMLAERRIIFTSRHLDRLSSCIQAANAFL 228
            ...||:..:|    |:.:....:..:..:::|.:||::|.|||:||.:..|..||||..|..|.|
Human   910 ELRRPMDSRL----EHVDFECLFTCLSVRQLIRIFASLLLERRVIFVADKLSTLSSCSHAVVALL 970

  Fly   229 YPMVWQHIFIPVLPWEFKDYLGAPMPYLIGVPEPVLETVTSDELGEVVILNCDTKIFESPFDDVH 293
            ||..|||.||||||....|.:..|.|:|:|:....|..:....:.|.:::|..:..|....||..
Human   971 YPFSWQHTFIPVLPASMIDIVCCPTPFLVGLLSSSLPKLKELPVEEALMVNLGSDRFIRQMDDED 1035

  Fly   294 N-LPTEIVSQLKKHLNHTHDHIGD---------------RISKIFLNALVQLIGGYR-DAVEYHE 341
            . ||.::.:.|::.|...::.|..               .:|::|:...|:.:|.|. ...:..:
Human  1036 TLLPRKLQAALEQALERKNELISQDSDSDSDDECNTLNGLVSEVFIRFFVETVGHYSLFLTQSEK 1100

  Fly   342 NSKTFNSQKFIES-RPAHLRPFLAKMMDLQIFAQFIDDRLTMLNSGLGFSDEFELETVRYAEK-- 403
            ..:.|..:.|.:| ....:|.||...|:.|:||.||.||........|.   ||....:|.|:  
Human  1101 GERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKGL---FEQRVEQYLEELP 1162

  Fly   404 --KKRGRNYAIMKNLKDK 419
              ::.|.| ..::.|.:|
Human  1163 DTEQSGMN-KFLRGLGNK 1179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18659NP_665880.2 uDENN 10..95 CDD:214824 29/122 (24%)
DENN 98..282 CDD:280329 54/186 (29%)
dDENN 315..379 CDD:129037 17/80 (21%)
DENND2BXP_011518611.1 uDENN 727..814 CDD:214824 28/95 (29%)
DENN 841..1022 CDD:280329 53/184 (29%)
dDENN 1073..1139 CDD:129037 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3569
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.