DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18659 and Dennd2a

DIOPT Version :9

Sequence 1:NP_665880.2 Gene:CG18659 / 35929 FlyBaseID:FBgn0027561 Length:908 Species:Drosophila melanogaster
Sequence 2:XP_006236416.1 Gene:Dennd2a / 312257 RGDID:1306142 Length:998 Species:Rattus norvegicus


Alignment Length:472 Identity:119/472 - (25%)
Similarity:196/472 - (41%) Gaps:84/472 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKNDVKKLFEFWCEVTPTPGLERGTSSRSGGPAVPAGVIVESFP----EGFR----DQEVLTGIP 61
            |:...::|||::..|:    |.:   .::|...||.  :.:.||    :.|:    .::.|..||
  Rat   548 IEYQERQLFEYFVVVS----LHK---KQAGAAYVPE--LTQQFPLKLEKSFKFLREAEDQLKAIP 603

  Fly    62 SFAFPCDTTSTSVQ-----TYSFVHTTGDSKWRFGFCR------QDPRTNTAMVLITYLPWHDTF 115
            .|.||.....:.||     |:|||.|..|...|||:||      :..|......:::.|.....|
  Rat   604 QFCFPDAKDWSPVQEFTSETFSFVLTGEDGSRRFGYCRRLLPGGKGKRLPEVYCIVSRLGCFSLF 668

  Fly   116 LKLLPVLAELRRTDPNGFRTFLSEAYNQGIPDCGGSLKV-YYSAGQSHFTFE--RPLQFQLPSMP 177
            .|:|..:.:.|...|...:..:........|..|.::.| .:..|......|  |||..:|    
  Rat   669 SKILDEVEKRRGISPALVQPLMRSVMEAPFPALGKTITVKNFLPGSGTEVIELCRPLDSRL---- 729

  Fly   178 ENHNLNLYYNFVEPKEMIAVFAAMLAERRIIFTSRHLDRLSSCIQAANAFLYPMVWQHIFIPVLP 242
            |:.:....::.:..:.:::|||::|.|||:||.:..|..||.|..|..|.:||..|||.:|||||
  Rat   730 EHVDFESLFSSLSVRHLVSVFASLLLERRVIFIADKLSTLSKCCHAMVALIYPFSWQHTYIPVLP 794

  Fly   243 WEFKDYLGAPMPYLIGVPEPVLETVTSDELGEVVILNCDTKIFESPFDDVHN-LPTEIVSQLKKH 306
            ....|.:.:|.|:|||:....|..:....|.||::::.....|....:|..: ||.::...|:..
  Rat   795 PAMIDIVCSPTPFLIGLLSSSLPLLRELPLEEVLVVDLINDRFLRQMEDEDSILPRKLQVALEHI 859

  Fly   307 LNHTHD-------------------HIGDRISKIFLNALVQLIGGY-------------RDAVEY 339
            |...:|                   .:.:.:|:.|:...|:::|.|             |:|...
  Rat   860 LEQRNDLACDQDGGPLDCVHGPESSSLSEVVSEAFVRFFVEIVGHYSLFLTSGEERSLQREAFRK 924

  Fly   340 HENSKTFNSQKFIESRPAHLRPFLAKMMDLQIFAQFIDDRLTMLNSGLGFSDEFELETVRYAEKK 404
            ..:||:             ||.||...|:.|.|..||.:|........|.   ||:....|.|..
  Rat   925 AVSSKS-------------LRRFLEVFMETQTFRGFIQERELRRQDAKGL---FEVRAQEYLETL 973

  Fly   405 KRGRNYAIMKNLKDKTN 421
            ..|.:..:.|.||...|
  Rat   974 PSGEHSGVNKFLKGLGN 990

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18659NP_665880.2 uDENN 10..95 CDD:214824 30/103 (29%)
DENN 98..282 CDD:280329 52/186 (28%)
dDENN 315..379 CDD:129037 18/76 (24%)
Dennd2aXP_006236416.1 uDENN 552..644 CDD:214824 30/100 (30%)
DENN 651..807 CDD:396629 44/159 (28%)
dDENN 893..951 CDD:129037 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3569
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.