DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18659 and Dennd2b

DIOPT Version :9

Sequence 1:NP_665880.2 Gene:CG18659 / 35929 FlyBaseID:FBgn0027561 Length:908 Species:Drosophila melanogaster
Sequence 2:XP_038934122.1 Gene:Dennd2b / 308944 RGDID:1308995 Length:1153 Species:Rattus norvegicus


Alignment Length:474 Identity:126/474 - (26%)
Similarity:200/474 - (42%) Gaps:83/474 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKLFEFWCEVTPTPGLERGTSSRSGGPAVPAGVIVESFPEGFRD-------QEVLTGIPSFAFP- 66
            ::|||::..|:    |::..|..:..|.|.     ..||:..|.       :|.|..||.|.|| 
  Rat   691 RELFEYFVVVS----LKKKPSRNTYLPEVS-----YQFPKLDRPTKQMREAEERLKAIPQFCFPD 746

  Fly    67 ----CDTTSTSVQTYSFVHTTGDSKWRFGFCR------QDPRTNTAMVLITYLPWHDTFLK---- 117
                ...:..|.:|:||:.|..|...|||:||      :.||......:|:.|.....|.|    
  Rat   747 AKDWLPVSEYSSETFSFMLTGEDGSRRFGYCRRLLPNGKGPRLPEVYCVISRLGCFGLFSKEVEK 811

  Fly   118 ----LLP--------VLAELRRTDPNGFRT-----FLSEAYNQGIPDCGGSLKV---YYSAGQSH 162
                |.|        ||.|:.|.  .|...     |:........|..|.::||   ...||...
  Rat   812 ALPTLFPLGCWWCAQVLDEVERR--RGISAALVYPFMRSLMESPFPAPGKTIKVKTFLPGAGNEV 874

  Fly   163 FTFERPLQFQLPSMPENHNLNLYYNFVEPKEMIAVFAAMLAERRIIFTSRHLDRLSSCIQAANAF 227
            ....||:..:|    |:.:....:..:..:::|.:||::|.|||:||.:..|..||||..|..|.
  Rat   875 LELRRPMDSRL----EHVDFECLFTCLSVRQLIRIFASLLLERRVIFVADKLSTLSSCSHAVVAL 935

  Fly   228 LYPMVWQHIFIPVLPWEFKDYLGAPMPYLIGVPEPVLETVTSDELGEVVILNCDTKIFESPFDDV 292
            |||..|||.||||||....|.:..|.|:|:|:....|..:....:.|.:::|..:..|....||.
  Rat   936 LYPFSWQHTFIPVLPASMIDIVCCPTPFLVGLLSSSLPKLKELPVEEALMVNLGSDRFIRQMDDE 1000

  Fly   293 HN-LPTEIVSQLKKHLNHTHDHIGD---------------RISKIFLNALVQLIGGYRDAVEYHE 341
            .. ||.::.:.|::.|...::.|..               .:|::|:...|:.:|.|...:.:.|
  Rat  1001 DTLLPRKLQAALEQALERKNELISQDSDSDSDDECNTLNGLVSEVFIRFFVETVGHYSLFLTHSE 1065

  Fly   342 -NSKTFNSQKFIES-RPAHLRPFLAKMMDLQIFAQFIDDRLTMLNSGLGFSDEFELETVRYAEK- 403
             ..:.|..:.|.:| ....:|.||...|:.|:||.||.||........|.   ||....:|.|: 
  Rat  1066 KGERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKGL---FEQRVEQYLEEL 1127

  Fly   404 ---KKRGRNYAIMKNLKDK 419
               ::.|.| ..::.|.:|
  Rat  1128 PDTEQSGMN-KFLRGLGNK 1145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18659NP_665880.2 uDENN 10..95 CDD:214824 29/102 (28%)
DENN 98..282 CDD:280329 59/207 (29%)
dDENN 315..379 CDD:129037 18/80 (23%)
Dennd2bXP_038934122.1 uDENN 694..781 CDD:214824 28/95 (29%)
DENN 788..988 CDD:396629 58/205 (28%)
dDENN 1039..1105 CDD:129037 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.