DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18659 and DENND2A

DIOPT Version :9

Sequence 1:NP_665880.2 Gene:CG18659 / 35929 FlyBaseID:FBgn0027561 Length:908 Species:Drosophila melanogaster
Sequence 2:NP_001304981.1 Gene:DENND2A / 27147 HGNCID:22212 Length:1009 Species:Homo sapiens


Alignment Length:463 Identity:119/463 - (25%)
Similarity:197/463 - (42%) Gaps:64/463 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKNDVKKLFEFWCEVTPTPGLERGTSSRSGGPAVPAGVIVESFP----EGFR----DQEVLTGIP 61
            |:...::|||::..|:    |.:   .::|...||.  :.:.||    ..|:    .::.|..||
Human   557 IEYQERQLFEYFVVVS----LHK---KQAGAAYVPE--LTQQFPLKLERSFKFMREAEDQLKAIP 612

  Fly    62 SFAFPCDTTSTSVQ-----TYSFVHTTGDSKWRFGFCR------QDPRTNTAMVLITYLPWHDTF 115
            .|.||.......||     |:|||.|..|...|||:||      :..|......:::.|.....|
Human   613 QFCFPDAKDWVPVQQFTSETFSFVLTGEDGSRRFGYCRRLLPGGKGKRLPEVYCIVSRLGCFSLF 677

  Fly   116 LKLLPVLAELRRTDPNGFRTFLSEAYNQGIPDCGGSLKV-YYSAGQSHFTFE--RPLQFQLPSMP 177
            .::|..:.:.|...|...:..:........|..|.::.| .:..|......|  |||..:|    
Human   678 SRILDEVEKRRGISPALVQPLMRSVMEAPFPALGKTILVKNFLPGSGTEVIELCRPLDSRL---- 738

  Fly   178 ENHNLNLYYNFVEPKEMIAVFAAMLAERRIIFTSRHLDRLSSCIQAANAFLYPMVWQHIFIPVLP 242
            |:.:....::.:..:.::.|||::|.|||:||.:..|..||.|..|..|.:||..|||.:|||||
Human   739 EHVDFESLFSSLSVRHLVCVFASLLLERRVIFIADKLSILSKCCHAMVALIYPFAWQHTYIPVLP 803

  Fly   243 WEFKDYLGAPMPYLIGVPEPVLETVTSDELGEVVILNCDTKIFESPFDDVHN-LPTEIVSQLKKH 306
            ....|.:.:|.|:|||:....|..:....|.||::::.....|....||..: ||.::...|:..
Human   804 PAMVDIVCSPTPFLIGLLSSSLPLLRELPLEEVLVVDLVNSRFLRQMDDEDSILPRKLQVALEHI 868

  Fly   307 LNHTHD-------------H------IGDRISKIFLNALVQLIGGYRDAVEYHE-NSKTFNSQKF 351
            |...::             |      :.:.:|:.|:...|:::|.|...:...| ..:|...:.|
Human   869 LEQRNELACEQDEGPLDGRHGPESSPLNEVVSEAFVRFFVEIVGHYSLFLTSGEREERTLQREAF 933

  Fly   352 ---IESRPAHLRPFLAKMMDLQIFAQFIDDRLTMLNSGLGFSDEFELETVRYAEKKKRGRNYAIM 413
               :.|:  .||.||...|:.|:|..||.:|........|.   ||:....|.|....|.:..:.
Human   934 RKAVSSK--SLRHFLEVFMETQMFRGFIQERELRRQDAKGL---FEVRAQEYLETLPSGEHSGVN 993

  Fly   414 KNLKDKTN 421
            |.||...|
Human   994 KFLKGLGN 1001

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18659NP_665880.2 uDENN 10..95 CDD:214824 30/103 (29%)
DENN 98..282 CDD:280329 51/186 (27%)
dDENN 315..379 CDD:129037 18/67 (27%)
DENND2ANP_001304981.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..153
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..334
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..479
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..532
uDENN 561..653 CDD:214824 30/100 (30%)
DENN 660..816 CDD:307995 43/159 (27%)
dDENN 896..962 CDD:129037 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3569
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.