DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and yncG

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_415971.1 Gene:yncG / 946023 ECOCYCID:G6765 Length:205 Species:Escherichia coli


Alignment Length:97 Identity:23/97 - (23%)
Similarity:39/97 - (40%) Gaps:17/97 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DLELKPVDFAKKEH--LSEEFVK-LNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPR 89
            |:..:.||.:..:|  .|.|.:| |||..|:|.....:.|:..::.||...:             
E. coli    23 DIPYQFVDVSGFDHEGASRELLKTLNPLCQVPTLALENDEIMTETAAIALMV------------- 74

  Fly    90 DLKRRAHIDHRMHYENGVLFQVVKDIVARNIY 121
             |.||..:...:......|||.:...:..|:|
E. coli    75 -LDRRPDLAPPVGRAERQLFQRLLVWLVANVY 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 23/97 (24%)
yncGNP_415971.1 GstA 1..203 CDD:440390 23/97 (24%)

Return to query results.
Submit another query.