DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and sspA

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:101 Identity:22/101 - (21%)
Similarity:48/101 - (47%) Gaps:22/101 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LFSPPA-----RACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDS 69
            |||.|.     :..|::|:. |:..|::.|:   |::..::.:.|||...:|..||.:..:: :|
E. coli    13 LFSGPTDIYSHQVRIVLAEK-GVSFEIEHVE---KDNPPQDLIDLNPNQSVPTLVDRELTLW-ES 72

  Fly    70 HAIVCFLVAKY------------AGNDQLYPRDLKR 93
            ..|:.:|..::            .|..:||...:::
E. coli    73 RIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 22/101 (22%)
sspANP_417696.1 sspA 1..211 CDD:236537 22/101 (22%)

Return to query results.
Submit another query.