DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTO1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens


Alignment Length:198 Identity:57/198 - (28%)
Similarity:82/198 - (41%) Gaps:28/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            :|...|.|.|....||.|..|:..|:..::...|   .|.|.|.||...:||..:|.|::..:| 
Human    26 IYSMRFCPFAERTRLVLKAKGIRHEVININLKNK---PEWFFKKNPFGLVPVLENSQGQLIYES- 86

  Fly    71 AIVC-FLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNI-------YGGEGEY 127
            ||.| :|...|.|. :|.|.|...:|  ..:|..|   ||..|..:|...|       |.|..|.
Human    87 AITCEYLD
EAYPGK-KLLPDDPYEKA--CQKMILE---LFSKVPSLVGSFIRSQNKEDYAGLKEE 145

  Fly   128 NPRSLTLCHNAYSDLEHFL--QQGSFVVGNELSVADVSIHTTLVTLDLLIPVE-REKYPQTKQWM 189
            ..:..|       .||..|  ::.:|..||.:|:.|..|......|:.:...| .:..|:.|.||
Human   146 FRKEFT-------KLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWM 203

  Fly   190 ERM 192
            ..|
Human   204 AAM 206

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 92..211 CDD:198287 28/111 (25%)
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 23/71 (32%)