DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Clic5

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:239 Identity:51/239 - (21%)
Similarity:85/239 - (35%) Gaps:85/239 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQI-----PVFVDSDGEVYVDSHAIVCFLVAK 79
            :|..:..:||:.||.|.                |.:     |.|:..:|:|..|.:.|..||  :
  Rat    47 VVFNVTTVDLKRKPADL----------------HNLAPGTHPPFLTFNGDVKTDVNKIEEFL--E 93

  Fly    80 YAGNDQLYPRDLKRRAHIDHRMHYENGV-LFQ----VVKDIVARNIYGGEGEYNPRSLTLCHNAY 139
            .....:.||:...|     ||.....|: :|.    .:|:...:|....|     |.||   .|.
  Rat    94 ETLTPEKYPKLAAR-----HRESNTAGIDIFSKFSAYIKNTKQQNNAALE-----RGLT---KAL 145

  Fly   140 SDLEHFL---------------QQGS---FVVGNELSVADVSIHTTLVTLDLL--------IPVE 178
            ..|:.:|               ::||   |:.|:||::||.::...|..:.::        ||.|
  Rat   146 RKLDDYLNTPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE 210

  Fly   179 REKYPQTKQWMERMDKLLPDNEEINLKGARALQTRILSCMAENK 222
                 .|..|.             .||.|.|......:|.|:::
  Rat   211 -----MTGLWR-------------YLKNAYARDEFTNTCAADSE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 15/62 (24%)
GST_C_Delta_Epsilon 92..211 CDD:198287 32/149 (21%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 15/68 (22%)
O-ClC 14..249 CDD:129941 51/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.