DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and CAM1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:55/217 - (25%)
Similarity:96/217 - (44%) Gaps:33/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLY--YALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDG 63
            ||:.|||  :.:.:...|..:   |.:.||:::...|.|     :|:|.:..|..::|.||...|
Yeast     1 MSQGTLYANFRIRTWVPRGLV---KALKLDVKVVTPDAA-----AEQFARDFPLKKVPAFVGPKG 57

  Fly    64 EVYVDSHAIVCFLVAKYAGNDQLYPR------DLKRRAHIDHRMHYENGVL-FQVVKDIVARNIY 121
            ....::.||..:|| |.:.:|::..:      ||..:|.|.......|..| .|:...||.  :.
Yeast    58 YKLTEAMAINYYLV-KLSQDDKMKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVP--LK 119

  Fly   122 GGEGEYNPRSLTLCHNAYSDL----EHFLQQGSFVVGNELSVADV---SIHTTLVTLDLLIPVE- 178
            || ..||.:|:....:|...:    |:.|:..:::....:|:||:   ||.|..  .:.|...| 
Yeast   120 GG-APYNKKSVDSAMDAVDKIVDIFENRLKNYTYLATENISLADLVAASIFTRY--FESLFGTEW 181

  Fly   179 REKYPQTKQWME--RMDKLLPD 198
            |.::|...:|..  |....|.|
Yeast   182 RAQHPAIVRWFNTVRASPFLKD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/75 (25%)
GST_C_Delta_Epsilon 92..211 CDD:198287 29/118 (25%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 20/77 (26%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 29/117 (25%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345095
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.