DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and URE2

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:51/242 - (21%)
Similarity:93/242 - (38%) Gaps:61/242 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPTLYYALFS----PPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVD--S 61
            :|...|.|||    |......:|...:|.......:||...||.:.|||.:||..::|..:|  .
Yeast   109 QPLEGYTLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGM 173

  Fly    62 DGEVYVDSHAIVCFLVAKY---AGNDQLYPRDLKRRAHID------------------HRMHYEN 105
            |.....:|.||:..||.||   .||..|:..||..::.|:                  |..::.:
Yeast   174 DNLSIWESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHS 238

  Fly   106 GVLFQVVKDIV--ARNIYG--------------------GEGEYNPRSLTLCHNAYSDLEHFLQQ 148
            ..:...|:...  .|.:||                    ....|:..:..:..:.:.|...:|  
Yeast   239 QKIASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWL-- 301

  Fly   149 GSFVVGNELSVADVSI---HTTLVTLDLLIPVEREKYPQTKQWMERM 192
                ||::|::||::.   :..:..:.:.|.:|   :|:..:|.:.|
Yeast   302 ----VGDKLTIADLAFVPWNNVVDRIGINIKIE---FPEVYKWTKHM 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 24/79 (30%)
GST_C_Delta_Epsilon 92..211 CDD:198287 19/144 (13%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 26/79 (33%)
GST_C_Ure2p 208..350 CDD:198326 19/143 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.