DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and YGR201C

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:49/228 - (21%)
Similarity:78/228 - (34%) Gaps:59/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLYYALFSPPARACILVAKLI-GLDLELKPVDFAKKEHLSE-EFVKLNPQHQIPVFVDSDG 63
            ||..||:..|........|:...|: .|.|::|..|.:..:.|.| ||    |..:.|.||....
Yeast     1 MSDGTLFTDLKERKLIRTIVPRGLVRSLKLDVKLADPSDAQQLYEREF----PLRKYPTFVGPHD 61

  Fly    64 E-VYVDSHAIVCFLV----AKYAGNDQLYPR-DLKRRAHIDHRMHYE------------------ 104
            | ...::.||..:|:    .|.|....|.|. |.|.||.|   :.:|                  
Yeast    62 EWTLTEAMAIDYYLIHLSSDKEAVRQLLGPEGDFKTRADI---LRWESLSNSDFLNEVCEVFFPL 123

  Fly   105 ------NGVLFQVVKDIVARNIYGGEGEYNPRSLTLC--HNAYSDLEHFLQQGSFVVGNELSVAD 161
                  |...|:..::.|...:...|.....:...:|  |...:||   :...:|.:|       
Yeast   124 IGVKPYNATEFKAARENVDTIVSLYEKRLKKQQYLVCDDHETLADL---ISAAAFSLG------- 178

  Fly   162 VSIHTTLVTLDLLIPVEREKYPQTKQWMERMDK 194
                    .:.......|.|:|:..:|..|:.|
Yeast   179 --------FISFFDETWRSKHPEVTRWFNRVIK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 21/80 (26%)
GST_C_Delta_Epsilon 92..211 CDD:198287 21/129 (16%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 21/77 (27%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 20/127 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345082
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.