DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GTT2

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:225 Identity:54/225 - (24%)
Similarity:89/225 - (39%) Gaps:52/225 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PARACILVA-KLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLV 77
            |||..|.:| |.:...::...::..|.||...||:..|....:||....||.:..:..||..::.
Yeast    30 PARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTLIAECTAITEYID 94

  Fly    78 AKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVK-------DIVARNIY--------GGEGE- 126
            |            |.....:..:...|.||:..:.|       |.|  ::|        |.|.| 
Yeast    95 A------------LDGTPTLTGKTPLEKGVIHMMNKRAELELLDPV--SVYFHHATPGLGPEVEL 145

  Fly   127 YNPR--SLTLCHNAYSDLEHF---LQQGSFVVGNELSVADVSIHTTLV---TLDLLIPVEREKYP 183
            |..:  .|.....|...:.:|   |::..:|.|:..|:||:::...|:   .:.|.:|.|.|   
Yeast   146 YQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIFAAIVKLQVPEECE--- 207

  Fly   184 QTKQWMERMD------KLLPDNEEINLKGA 207
            ..:.|.:||.      |||    ||..|.:
Yeast   208 ALRAWYKRMQQRPSVKKLL----EIRSKSS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 18/64 (28%)
GST_C_Delta_Epsilon 92..211 CDD:198287 34/146 (23%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 18/63 (29%)
GST_C_GTT2_like 106..222 CDD:198291 28/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345147
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1708
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.