DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and AT1G66235

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_683473.2 Gene:AT1G66235 / 842939 AraportID:AT1G66235 Length:284 Species:Arabidopsis thaliana


Alignment Length:122 Identity:27/122 - (22%)
Similarity:36/122 - (29%) Gaps:44/122 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 ENGVLFQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTL 168
            |:..|.||..||....|.|               .|...:||..:          ||:       
plant    11 EDKFLCQVYMDISQDPIIG---------------VYQSSDHFWDR----------VAE------- 43

  Fly   169 VTLDLLIPVEREKYPQTKQWMERMDKLLPDNEEINLKGARALQTRILSCMAENKAKS 225
                   ..|..|.|   .|.:|..|.|....:...|.::.|...|..|  ||:..|
plant    44 -------SFENRKNP---TWSKRSKKSLQCRLQTIEKASKKLHACIKLC--ENRRSS 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 17/87 (20%)
AT1G66235NP_683473.2 NAM-associated 114..266 CDD:464129
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.