DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTF14

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:228 Identity:59/228 - (25%)
Similarity:101/228 - (44%) Gaps:36/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GLDLELKPVDFAKKEHLSEEFVK-LNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAG-NDQLYP 88
            |||.||..||:...|..::.|:. |||..::||..|.|.::: :..||..:|..:|.. ...|.|
plant    27 GLDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLF-EPKAITRYLAEQYKDVGTNLLP 90

  Fly    89 RDLKRRAHIDHRMHYENG----VLFQVVKDIVARNIYGGEG------EYNPRSLTLCHNAYSDLE 143
            .|.|:||.:...|..::.    :...::|:::. |.|.|..      :.|...|:...|.|   |
plant    91 DDPKKRAIMSMWMEVDSNQFLPIASTLIKELII-NPYQGLATDDTAVQENKEKLSEVLNIY---E 151

  Fly   144 HFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKY-------PQTKQWMERMDKLLP---- 197
            ..|.:..::.|...|:||  :| .|..:|.|:..:.|:.       |....|:|:| |:.|    
plant   152 TRLGESPYLAGESFSLAD--LH-HLAPIDYLLNTDEEELKNLIYSRPNVAAWVEKM-KMRPAWLK 212

  Fly   198 ----DNEEINLKGARALQTRILSCMAENKAKSQ 226
                .|..::|...|.|..::.|...|:...:|
plant   213 TVVMKNHIVDLMKQRRLPIKLDSSCHESTVVAQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/52 (37%)
GST_C_Delta_Epsilon 92..211 CDD:198287 32/143 (22%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 19/53 (36%)
GST_C_Phi 94..214 CDD:198296 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.