DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTF5

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:197 Identity:43/197 - (21%)
Similarity:76/197 - (38%) Gaps:18/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            :|...:|...|..:.|....||..:...|:....:.....|:.:||..|:|||:|. |....:|.
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDG-GLKLTESR 129

  Fly    71 AIVCFL--VAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIV----ARNIYGGEGEY-- 127
            ||..::  |.|..|...|..:..|........|..|:.....:...:.    .:.:||.:.:|  
plant   130 AISEYIA
TVHKSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPMYGLKTDYKV 194

  Fly   128 -NPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKY----PQTKQ 187
             |.....| .......|..|:..||:..|..::||: .|  |..:..|:....::.    |..::
plant   195 VNETEAKL-EKVLDIYEERLKNSSFLASNSFTMADL-YH--LPNIQYLMDTHTKRMFVNRPSVRR 255

  Fly   188 WM 189
            |:
plant   256 WV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/73 (26%)
GST_C_Delta_Epsilon 92..211 CDD:198287 20/109 (18%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 19/70 (27%)
GST_C_Phi 153..270 CDD:198296 20/109 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.