DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTF4

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:213 Identity:52/213 - (24%)
Similarity:89/213 - (41%) Gaps:31/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCF 75
            ||...|..:.|.....|..|...|.....||.:|.|:.|||..|:|||.|...::| :|.||..:
plant    44 FSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLY-ESRAITQY 107

  Fly    76 LVAKYAG-NDQLYPRDLKRRAH---------IDHRMHYENGVLFQVVKDIVARNIYGGEGEY--- 127
            :...::. ..||    |..|:|         ::...|..:....::..:.|.:.|||.|.:.   
plant   108 IA
YVHSSRGTQL----LNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKPIYGLETDQTIV 168

  Fly   128 --NPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVER--EKYPQTKQW 188
              |...|....|.|   |..|::..|:..|..::.|:. |...:...|..|.::  ||..:.::|
plant   169 KENEAILEKVLNIY---EKRLEESRFLACNSFTLVDLH-HLPNIQYLLGTPTKKLFEKRSKVRKW 229

  Fly   189 MERMD-----KLLPDNEE 201
            ::.:.     |:..|.|:
plant   230 VDEITSREAWKMACDQEK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 23/66 (35%)
GST_C_Delta_Epsilon 92..211 CDD:198287 26/131 (20%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 23/65 (35%)
GST_C_Phi 126..243 CDD:198296 22/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.