DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and AT1G09640

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_563848.1 Gene:AT1G09640 / 837491 AraportID:AT1G09640 Length:414 Species:Arabidopsis thaliana


Alignment Length:228 Identity:50/228 - (21%)
Similarity:99/228 - (43%) Gaps:40/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ARACILVAKLIGLDLELKPVDFAK-KEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVA 78
            |...::.|:.:|:.::: |.||.. ..:.:..|:|:||..::||....:|.|: :|:||..: |:
plant    14 AEKALIAAEYVGVQIDV-PSDFQMGVTNKTPAFLKMNPIGKVPVLETPEGSVF-ESNAIARY-VS 75

  Fly    79 KYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLE 143
            :..|::.|....|...|.|:..:.:.:   .::...|:  ..:|....:.|.|......|.|.|:
plant    76 RLNGDNSLNGSSLIEYAQIEQWIDFSS---LEIYASIL--RWFGPRMGFMPYSAPAEEGAISTLK 135

  Fly   144 H-------FLQQGSFVVGNELSVADVSIHTTLVTLDL-LIPVEREKYPQTKQWMER--------- 191
            .       .|...:::||:.:::||:   .|:..|:| ...|..:|:......:||         
plant   136 RALDALNTHLTSNTYLVGHSITLADI---ITVCNLNLGFATVMTKKFTSEFPHVERYFWTVVNQP 197

  Fly   192 -MDKLLPDNEEINLKGARALQTRILSCMAENKA 223
             ..|:|.|          ..||..:..:|..||
plant   198 NFTKVLGD----------VKQTEAVPPIASKKA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 42/195 (22%)
AT1G09640NP_563848.1 GST_N_EF1Bgamma 3..77 CDD:239342 18/65 (28%)
GST_C_EF1Bgamma_like 90..210 CDD:198290 25/137 (18%)
EF1G 255..361 CDD:459888
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.