DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Clic4

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_114006.2 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:193 Identity:36/193 - (18%)
Similarity:74/193 - (38%) Gaps:67/193 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LVAKLIGLDLELKPVDFAK-----------------------KEHLSE-----EFVKLNPQHQIP 56
            :|..:..:||:.||.|...                       :|.|.|     :::||:|:|.  
  Rat    50 VVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHP-- 112

  Fly    57 VFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIY 121
                       :|:.....:.||::.    |.::.:..|:    ...|.|:|..:.|        
  Rat   113 -----------ESNTAGMDIFAKFSA----YIKNSRPEAN----EALERGLLKTLQK-------- 150

  Fly   122 GGEGEY--NPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKY 182
              ..||  :|....:..|:..|::...::  |:.|:|:::||.::...|    .::.|..:||
  Rat   151 --LDEYLNSPLPDEIDENSMEDIKSSTRR--FLDGDEMTLADCNLLPKL----HIVKVVAKKY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 36/193 (19%)
Clic4NP_114006.2 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 9/50 (18%)
O-ClC 17..252 CDD:129941 36/193 (19%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.