DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTT2

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:220 Identity:62/220 - (28%)
Similarity:112/220 - (50%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYV 67
            |..:|....|.|:||.::..|:..:..:...:...|::.||.||.::||..::|..||...::: 
plant     2 KLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLF- 65

  Fly    68 DSHAIVCFLVAKYAG-NDQLYPRDLKRRAHID-----HRMHYENGVLFQVVKDIVARNIYGGEG- 125
            :||||:.:|.:.||. .|..||.||.:||.|.     |..:...|....|:..::|..:    | 
plant    66 ESHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPAL----GL 126

  Fly   126 EYNPRSL----TLCHNAYSDLEHFLQQGS--FVV-GNELSVADVSIHTTLVTLDLLIPVER---- 179
            ..||::.    .:..|:.|.||.|..:||  |:: |.:.|:||:|:...|:.|.:|...:|    
plant   127 PLNPKAAAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLRLL 191

  Fly   180 EKYPQTKQWMERMDK-LLPDNEEIN 203
            ..:.:.:||:|...| .:|.::|::
plant   192 SPHKKVEQWIESTRKATMPHSDEVH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 21/73 (29%)
GST_C_Delta_Epsilon 92..211 CDD:198287 33/130 (25%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 21/75 (28%)
GST_C_Theta 92..221 CDD:198292 33/129 (26%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.