DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTT3

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:221 Identity:59/221 - (26%)
Similarity:107/221 - (48%) Gaps:26/221 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYV 67
            |..:|....|.|:||.::..|:..:..:...:..|.::.||.||..:||..::|..|  ||::.:
plant     2 KLKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIV--DGKLKL 64

  Fly    68 -DSHAIVCFLVAKYAG-NDQLYPRDLKRRAHID-----HRMHYENGVLFQVVKDIVARNIYGGEG 125
             :||||:.:|.:.|.. .|..||.||.:||.|.     |..:...|....|:..::...:    |
plant    65 SESHAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPAL----G 125

  Fly   126 -EYNPRSLT----LCHNAYSDLEHFLQQGS--FVVG-NELSVADVSIHTTLVTLDLLIPVER--- 179
             ..||::..    |...:.:.|:.|..:|:  |::| |:.|:||:|:...|..|.:|...:|   
plant   126 LPLNPKAAAEAEQLLTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLRL 190

  Fly   180 -EKYPQTKQWMERMDK-LLPDNEEIN 203
             ..:...:||:|...| .:|..:|::
plant   191 LSPHKNVEQWIENTRKATMPHFDEVH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 22/74 (30%)
GST_C_Delta_Epsilon 92..211 CDD:198287 30/130 (23%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 55/205 (27%)
GST_N_Theta 3..78 CDD:239348 22/76 (29%)
GST_C_Theta 92..221 CDD:198292 30/129 (23%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.