DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTT1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:235 Identity:67/235 - (28%)
Similarity:113/235 - (48%) Gaps:27/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV 65
            |.|..:|....|.|:||.|:..|:.|:..:...:..||::.||.||..:||..::|..||...::
plant     1 MMKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKL 65

  Fly    66 YVDSHAIVCFLVAKYAG-NDQLYPRDLKRRAHID-----HRMHYENGVLFQVVKDIVARNIYGGE 124
            : :||||:.:|.:.:.. .|..||.||.:||.|.     |..:...|....|:..::...:    
plant    66 F-ESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPAL---- 125

  Fly   125 G-EYNPRSLT----LCHNAYSDLEHFLQQGS--FVVG-NELSVADVSIHTTLVTLDLLIPVER-- 179
            | ..||::..    |...:.|.||.|..:|:  |::| |:.|:||:|:...|:.|.:|...:|  
plant   126 GLPLNPKAAAEAEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLR 190

  Fly   180 --EKYPQTKQWMERMDK-LLP---DNEEINLKGARALQTR 213
              ..:.:.:||:|...| .:|   :..||..|.....|.|
plant   191 LLSTHKKVEQWIENTKKATMPHFDETHEILFKVKEGFQKR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 24/73 (33%)
GST_C_Delta_Epsilon 92..211 CDD:198287 34/139 (24%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 24/75 (32%)
GST_C_Theta 93..223 CDD:198292 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.