DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTF12

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:182 Identity:40/182 - (21%)
Similarity:72/182 - (39%) Gaps:46/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LFSPPARAC---ILVAKL-IGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            |:.....||   :|:..| .|::.|:..:|....|....|.:...|..|:|...|.|.::: :|.
plant     5 LYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLF-ESR 68

  Fly    71 AIVCFLVAKYAGNDQ---LYPRDLKRRAHIDH----RMHYENGVLFQVVKDIVARNIYGGEGE-- 126
            ||..:...|:|  ||   |..:.|:.||.:|.    ..:|.|.:...:|.:::.:...|.:.:  
plant    69 AIARYYATKFA--DQGTNLLGKSLEHRAIVDQWADVETYYFNVLAQPLVINLIIKPRLGEKCDVV 131

  Fly   127 ---------------YNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVS 163
                           ||.|               |....|:.|.|.::||::
plant   132 LVEDLKVKLGVVLDIYNNR---------------LSSNRFLAGEEFTMADLT 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 18/71 (25%)
GST_C_Delta_Epsilon 92..211 CDD:198287 16/93 (17%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 40/182 (22%)
GST_N_Phi 2..77 CDD:239351 18/72 (25%)
GST_C_Phi 91..209 CDD:198296 16/93 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.