DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTF2

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:218 Identity:49/218 - (22%)
Similarity:90/218 - (41%) Gaps:37/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LFSPPA----RACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            :|..||    |..::......||.||..|:....||..|.|:..||..|:|.|.|.|.::: :|.
plant     6 VFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLF-ESR 69

  Fly    71 AIVCFLVAKYAG-NDQLYPRDLKRRAHI----------DHRMHYENGVLFQVVKDIVARNIYG-- 122
            ||..::..:|.. ...|...|.|..:..          ||:.   :.|..::..:.:.::|||  
plant    70 AITQYIAHR
YENQGTNLLQTDSKNISQYAIMAIGMQVEDHQF---DPVASKLAFEQIFKSIYGLT 131

  Fly   123 ------GEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVER-- 179
                  .|.|   ..|....:.|   |..|::..::.|...::.|:. |...:...|..|.::  
plant   132 TDEAVVAEEE---AKLAKVLDVY---EARLKEFKYLAGETFTLTDLH-HIPAIQYLLGTPTKKLF 189

  Fly   180 EKYPQTKQWMERMDKLLPDNEEI 202
            .:.|:..:|:..:.| .|.:|::
plant   190 TERPRVNEWVAEITK-RPASEKV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 23/71 (32%)
GST_C_Delta_Epsilon 92..211 CDD:198287 23/131 (18%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 23/72 (32%)
GST_C_Phi 96..211 CDD:198296 22/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.