DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTF10

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:187 Identity:46/187 - (24%)
Similarity:80/187 - (42%) Gaps:51/187 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLYYALFSPPARACI-LVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVD 68
            |:|..||:...||.: ||.|  |:..|...||..|.|....|::.:.|..:|||.||.|.::: :
plant     4 TIYAPLFASSKRAVVTLVEK--GVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIF-E 65

  Fly    69 SHAIVCFLVAKY--AGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRS 131
            |.||:.::..||  .|.| |..:.::.|..::..:            |:.|.:       |:|..
plant    66 SRAIMRYIAEKYRSQGPD-LLGKTIEERGQVEQWL------------DVEATS-------YHPPL 110

  Fly   132 LTLCHN-AYSDLEHF------------------------LQQGSFVVGNELSVADVS 163
            |.|..| .::.|..|                        |.:..::.|:.:|:||::
plant   111 LALTLNIVFAPLMGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 26/73 (36%)
GST_C_Delta_Epsilon 92..211 CDD:198287 15/97 (15%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 46/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.