DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GSTF9

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:172 Identity:42/172 - (24%)
Similarity:78/172 - (45%) Gaps:23/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACI-LVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDS 69
            :|...|:.|.||.: |:.|  |:..|..|||..|.||....::.|.|...:|..||.|.::: :|
plant     5 VYGPHFASPKRALVTLIEK--GVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIF-ES 66

  Fly    70 HAIVCFLVAKY--AGNDQLYPRDLKRRAHIDHRMHYE----NGVLFQVVKDIVARNIYGGEGEYN 128
            .|::.::..||  .|.| |..:.::.|..::..:..|    :..|..:...|:..::.|     .
plant    67 RAVMRYVAEKYRSQGPD-LLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMG-----F 125

  Fly   129 PRSLTLCHNAYSDL-------EHFLQQGSFVVGNELSVADVS 163
            |....|...:...|       |..|.:..::.|:.:|:||::
plant   126 PSDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 92..211 CDD:198287 14/83 (17%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 42/172 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.