DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:212 Identity:42/212 - (19%)
Similarity:79/212 - (37%) Gaps:47/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            ||:...|..::...||....||..|.:.|...:.||....|::||...::||.:..| .:..|..
Human    49 LYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRD-NIISDYD 112

  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVV----KDIVARNIYGGEGEYNPRS 131
            .|:.::...:.|..               |....:|...|.:    :.:||         ..|..
Human   113 QIIDYVERTFTGGG---------------RGRCPSGFPAQPLAVPTEHVVA---------LMPEV 153

  Fly   132 LTLCHN---AYSDLEHFLQQGSFVVG-------------NELSVADVSIHTTLVTLDLLIPVERE 180
            .:|.|.   .|.:|...|...::..|             .:.:.|::..|....|.||: .::.|
Human   154 GSLQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLM-KLDHE 217

  Fly   181 KYPQ-TKQWMERMDKLL 196
            :.|| ::.::.:..||:
Human   218 EEPQLSEPYLSKQKKLM 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/71 (27%)
GST_C_Delta_Epsilon 92..211 CDD:198287 22/126 (17%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 42/212 (20%)
GST_N_GDAP1 47..119 CDD:239350 19/70 (27%)
GST_C_GDAP1L1 220..330 CDD:198335 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.