DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Clic3

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_030107910.1 Gene:Clic3 / 69454 MGIID:1916704 Length:268 Species:Mus musculus


Alignment Length:201 Identity:47/201 - (23%)
Similarity:79/201 - (39%) Gaps:60/201 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCF-- 75
            |..:...:|..|.|:...|..||..:...:.::|.   |..|:|:.: .||:|..|:..|..|  
Mouse    55 PSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFA---PGSQLPILL-YDGDVKTDTLQIEEFLE 115

  Fly    76 ----------LVAKY-----AGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEG 125
                      |..:|     ||||..:    |..|.|.:.:..::..|:|.:.            
Mouse   116 ETLGPPDFPSLAPRYRESNTAGNDIFH----KFSAFIKNPVPTQDNALYQQLL------------ 164

  Fly   126 EYNPRSLTLCHNAY--SDLEHFLQQ--------GSFVVGNELSVADVSIHTTLVTLD-------- 172
                |:||.. ::|  :.|:|.|.|        ..|:.|::.::||.|:...|..:|        
Mouse   165 ----RALTRL-DSYLRAPLDHELAQEPHLRESHRRFLDGDQFTLADCSLLPKLHIVDTVCAHFRQ 224

  Fly   173 LLIPVE 178
            |.||.|
Mouse   225 LPIPAE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 18/76 (24%)
GST_C_Delta_Epsilon 92..211 CDD:198287 24/105 (23%)
Clic3XP_030107910.1 O-ClC 43..261 CDD:129941 47/201 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844731
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.