Sequence 1: | NP_001188889.1 | Gene: | GstE13 / 35928 | FlyBaseID: | FBgn0033381 | Length: | 226 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030107910.1 | Gene: | Clic3 / 69454 | MGIID: | 1916704 | Length: | 268 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 47/201 - (23%) |
---|---|---|---|
Similarity: | 79/201 - (39%) | Gaps: | 60/201 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 PPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCF-- 75
Fly 76 ----------LVAKY-----AGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEG 125
Fly 126 EYNPRSLTLCHNAY--SDLEHFLQQ--------GSFVVGNELSVADVSIHTTLVTLD-------- 172
Fly 173 LLIPVE 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE13 | NP_001188889.1 | GST_N_Delta_Epsilon | 4..78 | CDD:239343 | 18/76 (24%) |
GST_C_Delta_Epsilon | 92..211 | CDD:198287 | 24/105 (23%) | ||
Clic3 | XP_030107910.1 | O-ClC | 43..261 | CDD:129941 | 47/201 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844731 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |