DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Gstz1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001102915.1 Gene:Gstz1 / 681913 RGDID:1589363 Length:216 Species:Rattus norvegicus


Alignment Length:196 Identity:55/196 - (28%)
Similarity:89/196 - (45%) Gaps:31/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPTLY-YALFSPPARACILVAKLIGLDLELKPVDFAKK--EHLSEEFVKLNPQHQIPVFVDSDGE 64
            ||.|| |...|...|..|.:| |.|:|.|:.|::..|.  :..||||..|||..|:|. :..||.
  Rat     5 KPVLYSYFRSSCSWRVRIALA-LKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPA-LKIDGI 67

  Fly    65 VYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYG------- 122
            ....|.||:.:| .:.....:|.|:|.::||            :.:::.|::|..|..       
  Rat    68 TIGQSLAILEYL-EETRPIPRLLPQDPQKRA------------IVRMISDLIASGIQPLQNLSVL 119

  Fly   123 ---GEGEYNPRSLTLCHNAYSDLEHFLQQ--GSFVVGNELSVADVSIHTTLVTLDLLIPVEREKY 182
               |:....|.:.....:.::.||..||.  |.:.||:|:|:|||.:...:...: ...|:...|
  Rat   120 KQVGQENQMPWAQKAITSGFNALEKILQSTAGKYCVGDEVSMADVCLAPQVANAE-RFKVDLSPY 183

  Fly   183 P 183
            |
  Rat   184 P 184

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 29/76 (38%)
GST_C_Delta_Epsilon 92..211 CDD:198287 22/104 (21%)
Gstz1NP_001102915.1 GST_N_Zeta 6..80 CDD:239340 29/76 (38%)
maiA 7..211 CDD:273527 53/194 (27%)
Glutathione binding. /evidence=ECO:0000250 14..19 1/4 (25%)