DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Eef1e1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_079656.1 Gene:Eef1e1 / 66143 MGIID:1913393 Length:174 Species:Mus musculus


Alignment Length:164 Identity:36/164 - (21%)
Similarity:69/164 - (42%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AKKEHLSEEFVKLNP--------QHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKR 93
            |.:..|.|:.:.|.|        :.||||...::|...:....|...|| |.|..:.|.....:.
Mouse     4 AAELRLLEKSLGLKPGNKYSAQGERQIPVLQTNNGPSLMGLSTIATHLV-KQAS
KEHLLGSTAEE 67

  Fly    94 RAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELS 158
            :|.:...:.      |:|.:      :.|...:.:.::|      ..||..:|:...::.|:.::
Mouse    68 KAMVQQWLE------FRVTR------VDGHSSKEDTQTL------LKDLNSYLEDKVYLAGHNIT 114

  Fly   159 VADV----SIHTTLVTLDLLIPVEREKYPQTKQW 188
            :||:    .:|..:|  ||.:. |:|||....:|
Mouse   115 LADILLYYGLHRFIV--DLTVQ-EKEKYLNVSRW 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 12/48 (25%)
GST_C_Delta_Epsilon 92..211 CDD:198287 20/101 (20%)
Eef1e1NP_079656.1 N-terminal. /evidence=ECO:0000250 2..56 14/52 (27%)
Linker. /evidence=ECO:0000250 57..63 1/5 (20%)
C-terminal. /evidence=ECO:0000250 64..152 20/103 (19%)
GST_C_AIMP3 65..165 CDD:198338 20/102 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.