DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gstr

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:232 Identity:63/232 - (27%)
Similarity:94/232 - (40%) Gaps:51/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARAC--ILVA----KLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGE 64
            ||:...|||   |  :::|    :|.|...:|  :.|.||||.|.|...|||:.|:|.|  ..||
Zfish     7 LYWGTGSPP---CWRLMIALEEKQLQGYKHKL--LSFDKKEHQSPEVKALNPRAQLPTF--KHGE 64

  Fly    65 VYVDSHAIVCFL---VAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGE 126
            :.|:.....|..   |.|..|. :|.|.:....|.:..|| :|...|.|.:.::...:....|||
Zfish    65 IVVNESFAACLYLESVFKSQGT-RLIPDNPAEMALVYQRM-FETENLQQKMYEVAFYDWLVPEGE 127

  Fly   127 YNPRSLTLCHNAYSDLEHF---------LQQGSFVVGNELSVADVSIHTTLVTLD-LLIPVER-- 179
            ....:|.  .|....:|..         :.:||::.|...|:|||.....:.... |..|.||  
Zfish   128 RLESALK--RNKEKLIEELKLWEGYLEKMGKGSYLAGKNFSMADVVCFPVIAYFPRLQCPKERCP 190

  Fly   180 ---EKYPQTK-----------QWMERMDKLLPDNEEI 202
               |.|...|           :|:|:     |..|:|
Zfish   191 RLMEYYEMVKDRPSIKASWPPEWLEK-----PVGEDI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 27/80 (34%)
GST_C_Delta_Epsilon 92..211 CDD:198287 31/137 (23%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 58/210 (28%)
GST_N_family 5..78 CDD:238319 27/77 (35%)
GST_C_family 99..199 CDD:198286 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589755
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.