DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gstt1a

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:208 Identity:55/208 - (26%)
Similarity:95/208 - (45%) Gaps:31/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            ||..|.|.|.|:..:.||:..:..|.|.||.:..|...:||.|::...::|...|.| .:..:|.
Zfish     5 LYLDLHSQPCRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGD-FLLTESI 68

  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYEN--------------GVLFQVVKDIVARNIY 121
            ||:.:|..|::..|..||.||::||.:|..:.:::              |||..|....|.:...
Zfish    69 AILLYLAGKHSTPDHWYPADLQKRAQVDEFLSWQHTNIRSHGSKVFWFKGVLPAVTGAPVPKEKM 133

  Fly   122 GGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVER-----EK 181
            ....|    .|.:....:.|  .|||...|::|:::|:||:     :..::::.||..     |.
Zfish   134 DSALE----DLNMSLKIFED--KFLQSRPFIIGDKISLADI-----VAIVEMMQPVATGVDVFEG 187

  Fly   182 YPQTKQWMERMDK 194
            .|....|.:|:.|
Zfish   188 RPALSAWRDRVKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 23/71 (32%)
GST_C_Delta_Epsilon 92..211 CDD:198287 26/122 (21%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 54/205 (26%)
GST_N_Theta 3..78 CDD:239348 23/73 (32%)
GST_C_Theta 91..217 CDD:198292 26/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.