DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gdap1l1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:206 Identity:40/206 - (19%)
Similarity:79/206 - (38%) Gaps:38/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            ||:...|..::...||....||..|.:.|.....|.....|::||...::|||:..| .:..|.:
Zfish    50 LYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGD-TIVSDYN 113

  Fly    71 AIVCFLVAKYAGND--QLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRSLT 133
            .|:.::...:.|:.  ||.|.:                          ...:|....:|......
Zfish   114 QIIDYIETNFVGDTVAQLIPDE--------------------------GTPMYARVQQYRELLDG 152

  Fly   134 LCHNAYSD---LEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKL 195
            |..:||:.   |...|...|.:  .:.:.|::..|......:|: .::.|:...|:.::.:..||
Zfish   153 LPMDAYTHGCILHPELTTDSMI--PKYATAEIRRHLANAASELM-KLDHEEPQLTEPYLSKQKKL 214

  Fly   196 LP---DNEEIN 203
            :.   |::.:|
Zfish   215 MAKILDHDNVN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/71 (27%)
GST_C_Delta_Epsilon 92..211 CDD:198287 17/118 (14%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 40/206 (19%)
Thioredoxin_like 48..120 CDD:294274 19/70 (27%)
GST_C_GDAP1L1 201..311 CDD:198335 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.