Sequence 1: | NP_001188889.1 | Gene: | GstE13 / 35928 | FlyBaseID: | FBgn0033381 | Length: | 226 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_687373.1 | Gene: | gdap1l1 / 562163 | ZFINID: | ZDB-GENE-080812-2 | Length: | 367 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 40/206 - (19%) |
---|---|---|---|
Similarity: | 79/206 - (38%) | Gaps: | 38/206 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
Fly 71 AIVCFLVAKYAGND--QLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRSLT 133
Fly 134 LCHNAYSD---LEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKL 195
Fly 196 LP---DNEEIN 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE13 | NP_001188889.1 | GST_N_Delta_Epsilon | 4..78 | CDD:239343 | 19/71 (27%) |
GST_C_Delta_Epsilon | 92..211 | CDD:198287 | 17/118 (14%) | ||
gdap1l1 | XP_687373.1 | GstA | 48..314 | CDD:223698 | 40/206 (19%) |
Thioredoxin_like | 48..120 | CDD:294274 | 19/70 (27%) | ||
GST_C_GDAP1L1 | 201..311 | CDD:198335 | 5/25 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589688 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |