DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gdap1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:240 Identity:51/240 - (21%)
Similarity:77/240 - (32%) Gaps:68/240 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVY 66
            ||..||:...|..::...|.....||..|...|.....||....|::|||..::||.| .|..|.
Zfish    38 SKLILYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLV-HDNHVI 101

  Fly    67 VDSHAIVCFLVAKYAGND--QLYPRDLKRRAH-IDHRMH---------YENGVLF--QVVKDI-- 115
            .|...|:.:|...:....  :|.|.:.....| :.|...         |.:|.:.  ::..|.  
Zfish   102 CDPTQIMDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYRELLDSLQMDAYTHGCILHPEITVDSHI 166

  Fly   116 -------VARNIYGGEGE---------------------------------YNPRSLTLCHNAYS 140
                   :...|...|.|                                 |..:.|....|...
Zfish   167 PAYATTHIRTQIGNTESELKKLAVENPDLKDAYIAKQRRLKSKLFDHDNMKYLKKLLDELENVLD 231

  Fly   141 DLEHFLQ-----------QGSFVVGNELSVADVSIHTTLVTLDLL 174
            .:|..||           |.:::.|:..|:||||:..||..|..|
Zfish   232 QVETELQRRSEETPEEGSQQAWLCGDFFSIADVSLAVTLHRLKFL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 22/73 (30%)
GST_C_Delta_Epsilon 92..211 CDD:198287 25/148 (17%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 49/238 (21%)
GST_N_GDAP1 40..112 CDD:239350 21/72 (29%)
GST_C_family 193..304 CDD:295467 17/84 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589742
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.