DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and CLIC6

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001303938.1 Gene:CLIC6 / 54102 HGNCID:2065 Length:704 Species:Homo sapiens


Alignment Length:209 Identity:46/209 - (22%)
Similarity:79/209 - (37%) Gaps:58/209 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKY----------- 80
            :||:.||.|..          .|.|... |.|:..||||..|.:.|..||..|.           
Human   509 VDLKRKPADLQ----------NLAPGTN-PPFMTFDGEVKTDVNKIEEFLEEKLAPPRYPKLGTQ 562

  Fly    81 ------AGND-----QLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYNPRSLTL 134
                  ||||     ..:.::.|:.|   :.:|.:|  |.:.::.:         ..|....|..
Human   563 HPESNSAGNDVFAKFSAFIKNTKKDA---NEIHEKN--LLKALRKL---------DNYLNSPLPD 613

  Fly   135 CHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVERE-KYP--QTKQW-------- 188
            ..:|||..:..:....|:.|:||::||.::...|..:.::....|: ::|  .|..|        
Human   614 EIDAYSTEDVTVSGRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDFEFPSEMTGIWRYLNNAYA 678

  Fly   189 MERMDKLLPDNEEI 202
            .:......|.::||
Human   679 RDEFTNTCPADQEI 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 43/197 (22%)
CLIC6NP_001303938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..446
PRK07764 <9..382 CDD:236090
13 X 10 AA tandem repeat of G-D-[SNG]-[VIM]-[DEQ]-A-[EAG]-[GDVE]-[PRG]-[LAVP] 157..282
O-ClC 471..704 CDD:129941 46/209 (22%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 487..490
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.