DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Gstt3

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:221 Identity:62/221 - (28%)
Similarity:103/221 - (46%) Gaps:30/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            ||..|.|.|.||..:.||..|:..:|:.::..|.:|.::.|.::||..::|...|.| .|..:|.
  Rat    62 LYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGD-FVLAESV 125

  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARN----IYGGEGEYNPRS 131
            ||:.:|..||...|..||:||:.||.:|..:.:::..|.......:.:.    ::.|: ...|..
  Rat   126 AILLYLSRKY
KAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVFLGQ-PVPPER 189

  Fly   132 L--TL-----CHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVER-----EKYPQ 184
            |  ||     |.....|  .|||..:|:.|..:||||:     :...:|:.||..     |..|:
  Rat   190 LASTLAELDGCLQMLED--KFLQNKAFLTGPHISVADL-----VAITELMHPVSAGCKIFESRPK 247

  Fly   185 TKQWMERM-----DKLLPDNEEINLK 205
            ...|.:|:     :.|..:..|:.||
  Rat   248 LAAWRQRVEAAVGESLFQEAHEVVLK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 24/71 (34%)
GST_C_Delta_Epsilon 92..211 CDD:198287 31/135 (23%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 24/73 (33%)
GST_C_Theta 149..273 CDD:198292 29/131 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348140
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.