DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and clic5a

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:193 Identity:45/193 - (23%)
Similarity:72/193 - (37%) Gaps:67/193 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQI-----PVFVDSDGEVYVDSHAIVCFL--- 76
            :|..:..:||:.||.|.                |.:     |.|:..:|||..|.:.|..||   
Zfish    43 VVFNVTTVDLKRKPADL----------------HNLAPGTPPPFLTFNGEVRTDVNKIEEFLEEM 91

  Fly    77 --VAKY------------AGND-----QLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYG 122
              ..||            ||||     ..|.::.|..|:..    .|.|:| :|:|.:       
Zfish    92 LAPPKYPKLAAKNKESNTAGNDIFAKFSAYIKNTKPEANAS----LEKGLL-KVLKKL------- 144

  Fly   123 GEGEYN---PRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKY 182
             :...|   |..:    :|.|..|.......::.||||::||.::...|    .::.|..:||
Zfish   145 -DSFLNSPLPDEI----DAESTGEEKSSNRKYLDGNELTLADCNLLPKL----HVVKVVSKKY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 16/67 (24%)
GST_C_Delta_Epsilon 92..211 CDD:198287 22/94 (23%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 16/69 (23%)
O-ClC 10..244 CDD:129941 45/193 (23%)
GST_C_CLIC5 104..244 CDD:198330 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.