DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstD8

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:208 Identity:69/208 - (33%)
Similarity:118/208 - (56%) Gaps:10/208 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHA 71
            ||...|.|.|:.|:.||.:|:||.:|.:.....|.|..|||||||||.||..|| ||....:|.|
  Fly     4 YYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVD-DGFSIWESRA 67

  Fly    72 IVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIV---ARNIYGGEGEYNPRSLT 133
            |:.:||.||..:|.|||.|.:::|.::.|::::.|.|||...:.:   .||.:..:    |.::.
  Fly    68 ILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPAD----PEAMQ 128

  Fly   134 LCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLLPD 198
            ...:|:..|:.||:...:|.|:.|::||:::..::.|.: ::..:..:||...:|.|...::.|.
  Fly   129 KVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFE-VVDFDIAQYPNVARWYENAKEVTPG 192

  Fly   199 NEEINLKGARALQ 211
            .|| |..|.:.::
  Fly   193 WEE-NWDGVQLIK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 33/70 (47%)
GST_C_Delta_Epsilon 92..211 CDD:198287 28/121 (23%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 64/189 (34%)
GST_N_Delta_Epsilon 1..74 CDD:239343 33/70 (47%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/121 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460268
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.