DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstD4

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:211 Identity:72/211 - (34%)
Similarity:117/211 - (55%) Gaps:14/211 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHA 71
            ||:..|..:|..|:|||.:||:|..|.:...:.|||..||:||||||.||..||:...:: :|.|
  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIW-ESRA 67

  Fly    72 IVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIY-----GGEGEYNPRS 131
            |..:||.||..:|.|:|.|.::||.|:.|::::.|.|    .|...:..|     |..|  |..:
  Fly    68 IAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTL----HDSFMKYYYPFIRTGQLG--NAEN 126

  Fly   132 LTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLL 196
            ......|:..|:.||:...:|.|::|:|||::|.:::.|.: ::..:..|||...:|.....|:.
  Fly   127 YKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFE-VVEFDISKYPNVARWYANAKKIT 190

  Fly   197 PDNEEINLKGARALQT 212
            |..:| |.||...::|
  Fly   191 PGWDE-NWKGLLQMKT 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 31/70 (44%)
GST_C_Delta_Epsilon 92..211 CDD:198287 33/123 (27%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 65/187 (35%)
GST_N_Delta_Epsilon 1..74 CDD:239343 31/70 (44%)
GST_C_Delta_Epsilon 88..204 CDD:198287 33/123 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460307
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.