DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstD2

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:210 Identity:71/210 - (33%)
Similarity:114/210 - (54%) Gaps:14/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHA 71
            ||.......|..|:|||.:||:|..|.::..:.|.|..|||||||||.||..||:...:: :|.|
  Fly     4 YYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIW-ESRA 67

  Fly    72 IVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIY-----GGEGEYNPRS 131
            |..:||.||..:|.|.|.|.|:||.|:.|::::.|.|:    :..|:..|     |..|  :...
  Fly    68 IAVYLVE
KYGKDDYLLPNDPKKRAVINQRLYFDMGTLY----ESFAKYYYPLFRTGKPG--SDED 126

  Fly   132 LTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLL 196
            |.....|:..|:.||:...:|.|::|:|||::|.:|:.|.: :...:..||....:|.:...|:.
  Fly   127 LKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFE-VSEFDFSKYSNVSRWYDNAKKVT 190

  Fly   197 PDNEEINLKGARALQ 211
            |..:| |.:|..|::
  Fly   191 PGWDE-NWEGLMAMK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 30/70 (43%)
GST_C_Delta_Epsilon 92..211 CDD:198287 34/123 (28%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 30/70 (43%)
GST_C_Delta_Epsilon 88..204 CDD:198287 34/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460255
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.