DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:211 Identity:49/211 - (23%)
Similarity:86/211 - (40%) Gaps:48/211 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAK--KEHLSEEFVKLNPQHQIPVFVDSDG 63
            |.|.|||....:..|...::.|:..|  .::|..|..|  :.:.|.||:|..|..::|.|..::|
  Fly     1 MVKGTLYTYPENFRAYKALIAAQYSG--AQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEG 63

  Fly    64 EVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGEGEYN 128
            :...:|:|| .:|:|    |:||                  .|.....|:..|.:.|...:.|..
  Fly    64 QYLSESNAI-AYLLA----NEQL------------------RGGKCPFVQAQVQQWISFADNEIV 105

  Fly   129 PRSL----------------TLCHNAYSDLEHF---LQQGSFVVGNELSVADVSIHTTLVTL--D 172
            |.|.                |....|.:.|:..   ||..:|:.|..:::||:.:.::|:.|  .
  Fly   106 PASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEY 170

  Fly   173 LLIPVEREKYPQTKQW 188
            :|.|..|..:....:|
  Fly   171 VLEPSVRSAFGNVNRW 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 21/75 (28%)
GST_C_Delta_Epsilon 92..211 CDD:198287 22/118 (19%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 22/81 (27%)
GstA 5..187 CDD:223698 47/207 (23%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 20/97 (21%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.