DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gsto1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:202 Identity:51/202 - (25%)
Similarity:79/202 - (39%) Gaps:35/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            ||...|.|.|:...||....|:..:...::...|   .:.|::.||...:||.....|:|..:| 
Zfish    25 LYSMRFCPFAQRTRLVLNAKGIKYDTININLKNK---PDWFLEKNPLGLVPVLETQSGQVIYES- 85

  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVV-----KDIVARNIYGGEGEYNPR 130
            .|.|..:.:.....:|.|.|...||  ..||..|   ||..|     |..|.|.    :||....
Zfish    86 PITCEYLDEVYPEKKLLPFDPFERA--QQRMLLE---LFSKVTPYFYKIPVNRT----KGEDVSA 141

  Fly   131 SLTLCHNAYSDLEHFL--QQGSFVVGNELSVADVSI---HTTLVTLDLLIPVEREKY-----PQT 185
            ..|...:..|.....|  ::..|..|:.:::.|..:   ...|.|::|       |:     |:.
Zfish   142 LETELKDKLSQFNEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNL-------KHCLDGTPEL 199

  Fly   186 KQWMERM 192
            |:|.|||
Zfish   200 KKWTERM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/71 (27%)
GST_C_Delta_Epsilon 92..211 CDD:198287 29/116 (25%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 19/71 (27%)
GstA 25..210 CDD:223698 51/202 (25%)
GST_C_Omega 107..229 CDD:198293 29/116 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.