DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstD9

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:209 Identity:67/209 - (32%)
Similarity:113/209 - (54%) Gaps:20/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHA 71
            ||.|:|.|.|:.::.|:.:||:|..|.||....|||..||||:||||.||..|| ||....:|.|
  Fly     5 YYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVD-DGFAIWESRA 68

  Fly    72 IVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLF---------QVVKDIVARNIYGGEGEY 127
            |:.:|..||..:..|||:|.::||.|:.|:.::...|:         |:.:|:        :...
  Fly    69 ILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDV--------KKPA 125

  Fly   128 NPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERM 192
            :|.:|....:|::.....|:...:...|:|::||.::..|:.|.: :...:..|||:..:|.:..
  Fly   126 DPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFE-ISEYDFGKYPEVVRWYDNA 189

  Fly   193 DKLLPDNEEINLKG 206
            .|::|..|| |.:|
  Fly   190 KKVIPGWEE-NWEG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 34/70 (49%)
GST_C_Delta_Epsilon 92..211 CDD:198287 27/124 (22%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 34/70 (49%)
GstA 4..187 CDD:223698 61/191 (32%)
GST_C_Delta_Epsilon 89..207 CDD:198287 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460294
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.