DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstZ2

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:195 Identity:45/195 - (23%)
Similarity:88/195 - (45%) Gaps:24/195 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKK--EHLSEEFVKLNPQHQIPVFVDSDGEV 65
            :|.||....|..:....:...|..:..::||:...|.  |....|:.::||..|:|. :..||..
  Fly    15 QPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPA-LQIDGHT 78

  Fly    66 YVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYE---NGVLFQVVKDIVARNIYGGEGEY 127
            .::|.||:.:| .:......|.|:|:.:||.:  |...|   :|:  |.:::::.. |:.||.:.
  Fly    79 LIESVAIMHYL-EETRPQRPLLPQDVHKRAKV--REIVEIICSGI--QPLQNLIVL-IHVGEEKK 137

  Fly   128 NPRSLTLCHNAYSDLEHFL--QQGSFVVGNELSVADVSI----------HTTLVTLDLLIPVERE 180
            ...:.......:..:|..|  ..|.:.||:|:|:||..:          |..|....:::.::||
  Fly   138 KEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRE 202

  Fly   181  180
              Fly   203  202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 44/193 (23%)
GstZ2NP_649895.1 maiA 17..221 CDD:273527 44/193 (23%)

Return to query results.
Submit another query.