DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gsta.1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_998559.1 Gene:gsta.1 / 406703 ZFINID:ZDB-GENE-040426-2720 Length:223 Species:Danio rerio


Alignment Length:171 Identity:54/171 - (31%)
Similarity:78/171 - (45%) Gaps:36/171 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EEFVKLNPQ-----HQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHY 103
            |:|.||...     .|:|: |:.||...|.|.||:.::..||    .||.:|||.||.||   .|
Zfish    39 EQFDKLLSDGALTFQQVPL-VEIDGMKLVQSKAILNYIAGKY----NLYGKDLKERAMID---IY 95

  Fly   104 ENGV--LFQVV----------KDIVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNE 156
            ..|:  |.:::          |:.|..||   |.:...|.|.:       .|..|...||:||.:
Zfish    96 SEGLIDLMEMIMVSPFTPAENKEKVFSNI---EEKAKVRFLPV-------FEKALANSSFLVGKQ 150

  Fly   157 LSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLLP 197
            ||.|||.:....:.|..|.|.....:|:.:.:.|:| |.||
Zfish   151 LSRADVHLLEATLMLQELFPSILATFPKIQAFQEQM-KALP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 13/38 (34%)
GST_C_Delta_Epsilon 92..211 CDD:198287 35/118 (30%)
gsta.1NP_998559.1 PTZ00057 1..196 CDD:173353 54/171 (32%)
Thioredoxin_like 4..82 CDD:294274 15/47 (32%)
GST_C_Alpha 86..218 CDD:198317 36/119 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D510902at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.