DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and gstt2

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:215 Identity:56/215 - (26%)
Similarity:95/215 - (44%) Gaps:37/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHA 71
            |..|.|.|.||.::..|...:...::.:...|.|..:.||.||||..::||..| :|.|..:|.|
Zfish    10 YLDLMSQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLED-NGFVLTESDA 73

  Fly    72 IVCFLVAKYAGNDQLYPRDLKRRAHIDH---------RMHYENGVLFQVVKDIVARNIYGGEGEY 127
            |:.:|...|...|..||:..::||.:|.         |||.......:|:..::.       |: 
Zfish    74 ILKYLATTY
KVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAATVFWQEVLLPLMT-------GQ- 130

  Fly   128 NPRSLTLCHNAYSDL--------EHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVER----- 179
             |.:......|.|||        ..||::.:|:.|:::|:||:     |...:|:.|:..     
Zfish   131 -PANTAKLEKALSDLSGTLDKLENMFLKRQAFLCGDDISLADL-----LAICELMQPMSSGRDIL 189

  Fly   180 EKYPQTKQWMERMDKLLPDN 199
            :..|:...|..|:...|.|:
Zfish   190 KDRPKLLSWRSRVQSALSDS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 24/70 (34%)
GST_C_Delta_Epsilon 92..211 CDD:198287 28/130 (22%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 24/72 (33%)
GST_C_Theta 95..220 CDD:198292 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.