DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and GstO1

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:244 Identity:48/244 - (19%)
Similarity:80/244 - (32%) Gaps:80/244 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILV--AK-----LIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPV--FVDS 61
            ||...|.|.|....||  ||     .|.::|..||          |.|..::...::|.  .|..
  Fly    24 LYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKP----------EWFSLVSSSTKVPALELVKE 78

  Fly    62 DGEVYVDSHAIVC-FLVAKYAGNDQLYPRDLKRRAH----IDHRMHYENGVLFQVVKDIVARNIY 121
            .|...:....|:| :|..||. ...|||:||.::|.    |:....:.|...:.::.|       
  Fly    79 QGNPVLIESLIICDYLDEKYP-EVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHD------- 135

  Fly   122 GGEGEYNPRSLTLCHNAYSDLEHFL-----------QQGSFVVGNELSVADVSI-------HTTL 168
                  ||..|.       |.:|:.           :...|..|:...:.|..:       .:..
  Fly   136 ------NPEQLV-------DTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLK 187

  Fly   169 VTLDLLIPVEREKYPQTKQWMERMDKLLPDNEEINLKGARALQTRILSC 217
            .|.:....:..|::|...:|.:.|                 :|.|.:.|
  Fly   188 YTFEQKFELSPERFPTLIKWRDLM-----------------IQDRAVKC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 21/81 (26%)
GST_C_Delta_Epsilon 92..211 CDD:198287 17/140 (12%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 20/80 (25%)
GstA 22..216 CDD:223698 46/239 (19%)
GST_C_Omega 109..234 CDD:198293 20/148 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.