DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and se

DIOPT Version :9

Sequence 1:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:219 Identity:46/219 - (21%)
Similarity:80/219 - (36%) Gaps:64/219 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDF--------AKKEHLSEEFVKLNPQHQIPV--FVD 60
            ||...|.|       .|:.:.|.|:.|.:.:        .|.|.|.|:    |||.::|.  .|.
  Fly    24 LYSMRFCP-------FAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEK----NPQGKVPALEIVR 77

  Fly    61 SDGEVYVDSHAIVCFLVAKYAGNDQLYPRD-LKRRAHIDHRMHYENGVLFQVVKDIVARNIYGGE 124
            ..|...:....::|..:.:......||||| ||:         .::.:|.:..:.::.......:
  Fly    78 EPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKK---------VQDKLLIERFRAVLGAFFKASD 133

  Fly   125 GEYNPRSLTLCHNAYSDLEHF-----------LQQGS-FVVGNELSVADVSIHTTLVTLDLL--- 174
            |              .|||.|           .::|: |..|.:..:.|..|......|:||   
  Fly   134 G--------------GDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQ 184

  Fly   175 ----IPVEREKYPQTKQWMERMDK 194
                ...::.::||...|:|||.:
  Fly   185 RGEDYNYDQSRFPQLTLWLERMKR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/81 (23%)
GST_C_Delta_Epsilon 92..211 CDD:198287 21/122 (17%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 19/81 (23%)
GstA 22..215 CDD:223698 46/219 (21%)
GST_C_Omega 109..229 CDD:198293 22/123 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.