DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE13 and Gr59f

DIOPT Version :10

Sequence 1:NP_610457.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:84 Identity:21/84 - (25%)
Similarity:32/84 - (38%) Gaps:21/84 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 NPRSLTL---CHNAYSDLEH----FLQQGSFVVGNELSVADVSIHTTLVTLD-LLIPVEREKYP- 183
            |...:|:   |.|.:..|.|    .|..|.||:|:....  |.:.|..|:|| .|..:|...|. 
  Fly    48 NTAPITILPGCPNRFYRLVHLSWMILWYGLFVLGSYWEF--VLVTTQRVSLDRYLNAIESAIYVV 110

  Fly   184 ----------QTKQWMERM 192
                      |.:.|..::
  Fly   111 HIFSIMLLTWQCRNWAPKL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE13NP_610457.1 GstA 5..192 CDD:440390 21/82 (26%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:473258 17/71 (24%)

Return to query results.
Submit another query.